Compounded Tirzepatide 5mg

描述

Compounded Tirzepatide: Advanced Dual-Action Therapy

Compounded Tirzepatide is a revolutionary dual-action peptide designed for weight loss and type 2 diabetes management. By targeting GLP-1 and GIP receptors, it enhances insulin sensitivity, regulates appetite, and achieves superior results compared to semaglutide, including improved HbA1c reduction and more effective fat loss.

Compounded Tirzepatide is a synthetic peptide designed for metabolic health and chronic disease management. It acts as a dual agonist targeting the following endogenous peptides:

• Glucagon-like peptide-1 (GLP-1)
• Glucose-dependent insulinotropic polypeptide (GIP)

The peptide’s structure is engineered to enhance receptor activation for GLP-1 and GIP while incorporating chemical modifications, such as a fatty acyl moiety, to extend its half-life and improve therapeutic stability (source).

---

Specifications

• Molecular Formula: C225H348N48O68
• Molecular Weight: 4813.58 g/mol
• Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRGG

---

Tirzepatide Research

General Research

Tirzepatide activates both GLP-1 and GIP receptors, with therapeutic potential in enhancing glucose metabolism, weight reduction, and insulin sensitivity across tissues such as the pancreas, adipose tissue, and gastrointestinal tract (Jakubowska et al., 2024).

Tirzepatide and Adipose Tissue

Research suggests Tirzepatide may reduce fat mass by promoting lipolysis and energy expenditure via GLP-1 and GIP receptor activation. This dual mechanism also supports the transformation of white adipose tissue into beige fat, further enhancing thermogenesis (Folli et al., 2023).

Tirzepatide and Liver Cells

Tirzepatide’s effects on liver cells may involve improved lipid metabolism, reduced hepatic steatosis, and mitochondrial biogenesis. These mechanisms are linked to better energy expenditure and enhanced metabolic health (Doggrell, 2023).

Tirzepatide and the Central Nervous System

Studies indicate that Tirzepatide may influence hunger and satiety by activating GLP-1 and GIP receptors in the hypothalamus, potentially reducing hunger signals like NPY and AgRP while promoting satiety (van Bloemendaal et al., 2014).

Tirzepatide and the Gastrointestinal Tract

By delaying gastric emptying and reducing ghrelin secretion, Tirzepatide may support sustained satiety and caloric reduction. These actions are mediated by GLP-1 receptor activation in the stomach and small intestine (Urva et al., 2023).

Tirzepatide and Pancreatic Cells

Tirzepatide’s dual agonism may enhance insulin secretion by beta cells and suppress glucagon release by alpha cells, optimizing glucose regulation and improving HbA1c levels (Rosenstock et al., 2023). Clinical trials report a significant reduction in HbA1c and weight loss, making it a promising candidate for diabetes treatment (Jastreboff et al., 2023).

---

References

1. Jakubowska et al., 2024
2. Folli et al., 2023
3. Doggrell, 2023
4. van Bloemendaal et al., 2014
5. Samms et al., 2021
6. Urva et al., 2023
7. Rosenstock et al., 2023
8. Jastreboff et al., 2023

---